DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ad and Cpr65Az

DIOPT Version :9

Sequence 1:NP_610773.1 Gene:Cpr49Ad / 36349 FlyBaseID:FBgn0033726 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster


Alignment Length:73 Identity:33/73 - (45%)
Similarity:45/73 - (61%) Gaps:2/73 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 IVEQNNDVNYGAGSYSYNYETENGIHGEERGVPVNIGNQQQEEQ-VEGAYSFITPEGLRVGVKYL 132
            |::..:.||.. |||.|.|||.|||..||.|...|.|.:..|.| .||::|:.:|||..:.:.|:
  Fly   116 IIKLESKVNTD-GSYMYEYETGNGIKAEEMGYLKNAGVEGAEAQTAEGSFSYTSPEGQEISLTYI 179

  Fly   133 ADANGFRP 140
            ||.|||:|
  Fly   180 ADENGFQP 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AdNP_610773.1 Chitin_bind_4 83..138 CDD:278791 25/55 (45%)
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:278791 25/55 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450051
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.