DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ad and Cpr49Ah

DIOPT Version :9

Sequence 1:NP_610773.1 Gene:Cpr49Ad / 36349 FlyBaseID:FBgn0033726 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_610777.1 Gene:Cpr49Ah / 36354 FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster


Alignment Length:139 Identity:47/139 - (33%)
Similarity:63/139 - (45%) Gaps:27/139 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LFVLTLAAIACEGQPQYNPYLRN----PYYRD---LYYRNRDLYNLRRFYDGFYKKYNPYIAAAQ 66
            |.:|.|.||:|:||..:....:|    |  ||   .::|:.|......:..  ..|||.      
  Fly     4 LILLVLLAISCQGQHHHQHQHQNVNNIP--RDDKPDHHRHEDHRETSTWIP--IIKYNK------ 58

  Fly    67 ARIVEQNNDVNYGAGSYSYNYETENGIHGEERGVPVNIGNQQQEEQVE-GAYSFITPEGLRVGVK 130
                ||::|     |||...|||.|.|..||.|...:.........|: |.||:.:|||..|.|:
  Fly    59 ----EQSDD-----GSYKTEYETGNSIIHEETGFLKDFDTNPNGVLVQHGQYSYQSPEGTLVNVQ 114

  Fly   131 YLADANGFR 139
            |.||.||||
  Fly   115 YTADENGFR 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AdNP_610773.1 Chitin_bind_4 83..138 CDD:278791 22/55 (40%)
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:395303 22/55 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.