DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ad and Cpr49Ac

DIOPT Version :9

Sequence 1:NP_610773.1 Gene:Cpr49Ad / 36349 FlyBaseID:FBgn0033726 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_725150.2 Gene:Cpr49Ac / 36348 FlyBaseID:FBgn0033725 Length:324 Species:Drosophila melanogaster


Alignment Length:147 Identity:35/147 - (23%)
Similarity:53/147 - (36%) Gaps:49/147 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 YNPYLRN--PYYRDLYYRNRDLY---------------------------NLRRFYD--GFYKKY 58
            |.||..:  ||..|....|.|||                           |:...||  |.:|..
  Fly   100 YGPYAGSNIPYVHDDRPYNHDLYTSTTTKKPTTTTKRTTTSTTTTTTTPRNILFNYDDEGRHKIL 164

  Fly    59 NPYIAAAQARIVEQNNDVNYGAGSYSYNYETENGIHGEERGVPVNIGNQQQEEQVEGAYSFITPE 123
            :      :..:.:|:        .|.::|.|||||:|||:....:.|.    ...:|.|.:...:
  Fly   165 H------KEEVRKQD--------KYDHSYLTENGIYGEEQAKLHHTGG----THAKGFYEYTGDD 211

  Fly   124 GLRVGVKYLADANGFRP 140
            |....|.|.::..||.|
  Fly   212 GKLYRVNYASNDGGFMP 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AdNP_610773.1 Chitin_bind_4 83..138 CDD:278791 16/54 (30%)
Cpr49AcNP_725150.2 Chitin_bind_4 175..226 CDD:278791 16/54 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439123
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D146314at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.