powered by:
Protein Alignment Cpr49Ad and Cpr47Ef
DIOPT Version :9
Sequence 1: | NP_610773.1 |
Gene: | Cpr49Ad / 36349 |
FlyBaseID: | FBgn0033726 |
Length: | 166 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_610660.2 |
Gene: | Cpr47Ef / 36194 |
FlyBaseID: | FBgn0033603 |
Length: | 612 |
Species: | Drosophila melanogaster |
Alignment Length: | 64 |
Identity: | 29/64 - (45%) |
Similarity: | 39/64 - (60%) |
Gaps: | 0/64 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 77 NYGAGSYSYNYETENGIHGEERGVPVNIGNQQQEEQVEGAYSFITPEGLRVGVKYLADANGFRP 140
|.|.|:|.::|||.|||..:|.|...|.|::.:...|.|:||:..|||..|.:.|.||.|||.|
Fly 143 NDGDGNYRFSYETGNGIKAQEEGTVKNKGSENEIPSVMGSYSYTNPEGELVEIMYTADENGFVP 206
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45450057 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1459720at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR10380 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.950 |
|
Return to query results.
Submit another query.