DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ad and CG15754

DIOPT Version :10

Sequence 1:NP_610773.1 Gene:Cpr49Ad / 36349 FlyBaseID:FBgn0033726 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_572894.1 Gene:CG15754 / 32307 FlyBaseID:FBgn0030492 Length:281 Species:Drosophila melanogaster


Alignment Length:101 Identity:31/101 - (30%)
Similarity:42/101 - (41%) Gaps:32/101 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 YNLRRFYDGFYKKYNPYIAAAQARIVEQNNDVNYGAGSYSYNYETENGIHGEERGVPVNIGNQQQ 109
            ||..|  |.||               |.|.|     |||.:.|...:||...|:|.   ...:|.
  Fly   182 YNAWR--DNFY---------------ELNED-----GSYIFGYSIPHGIRRWEKGY---YSEEQH 221

  Fly   110 EEQVEGAYSFITP----EGLRVGVK-YLADANGFRP 140
            ...|||.|  :.|    :|||..:: |.||:.|::|
  Fly   222 GRVVEGFY--VQPRHDSQGLRYELRCYRADSEGYQP 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AdNP_610773.1 Chitin_bind_4 83..138 CDD:459790 18/59 (31%)
CG15754NP_572894.1 None

Return to query results.
Submit another query.