DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ac and Cpr97Eb

DIOPT Version :9

Sequence 1:NP_725150.2 Gene:Cpr49Ac / 36348 FlyBaseID:FBgn0033725 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_651530.1 Gene:Cpr97Eb / 43259 FlyBaseID:FBgn0039481 Length:235 Species:Drosophila melanogaster


Alignment Length:115 Identity:31/115 - (26%)
Similarity:48/115 - (41%) Gaps:23/115 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 TTPRNILFNYD---DEGRHKILHKEEVRKQDKYDHSYLTENG-IYGEEQAKLHHTGGTHAKGFYE 206
            |||..||...|   |:|.:...: |...|..|.:..|  .|| :||:                |.
  Fly    26 TTPVPILKQIDKHNDDGSYTYGY-EAADKSFKIETKY--ANGEVYGK----------------YG 71

  Fly   207 YTGDDGKLYRVNYASNDGGFMPQGDHIHPIPDAIVRALKYVEEQHKINGG 256
            |..|.||:..:.|.::..||.|.|.||:..|..:..:..|....::::.|
  Fly    72 YVDDQGKVREIEYGASKRGFEPAGSHINVPPPTLTNSNPYPLGPNELDDG 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AcNP_725150.2 Chitin_bind_4 175..226 CDD:278791 11/51 (22%)
Cpr97EbNP_651530.1 Chitin_bind_4 44..91 CDD:278791 14/65 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.