DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ac and Edg78E

DIOPT Version :9

Sequence 1:NP_725150.2 Gene:Cpr49Ac / 36348 FlyBaseID:FBgn0033725 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001287140.1 Gene:Edg78E / 40354 FlyBaseID:FBgn0000551 Length:122 Species:Drosophila melanogaster


Alignment Length:98 Identity:24/98 - (24%)
Similarity:49/98 - (50%) Gaps:10/98 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 NYDDEGRHKILHKEEVRKQDKYDHSYLTENGIYGEEQAKLHHTGGTH-AKGFYEYTGDDGKLYRV 217
            |.:.:.:.:....:....:..|.::|.|.|||      ::...|..: |:|...|...:|:...:
  Fly    18 NINKDAQIRSFQNDATDAEGNYQYAYETSNGI------QIQEAGNANGARGAVAYVSPEGEHISL 76

  Fly   218 NYASNDGGFMPQGDHI---HPIPDAIVRALKYV 247
            .|.:::.|:.|.|||:   .|:|..::|||:|:
  Fly    77 TYTADEEGYHPVGDHLPTPPPVPAYVLRALEYI 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AcNP_725150.2 Chitin_bind_4 175..226 CDD:278791 12/51 (24%)
Edg78ENP_001287140.1 Chitin_bind_4 39..85 CDD:395303 12/51 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439156
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D146314at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.