powered by:
Protein Alignment Cpr49Ac and Lcp65Aa
DIOPT Version :9
Sequence 1: | NP_725150.2 |
Gene: | Cpr49Ac / 36348 |
FlyBaseID: | FBgn0033725 |
Length: | 324 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_477280.1 |
Gene: | Lcp65Aa / 38709 |
FlyBaseID: | FBgn0020645 |
Length: | 102 |
Species: | Drosophila melanogaster |
Alignment Length: | 65 |
Identity: | 19/65 - (29%) |
Similarity: | 33/65 - (50%) |
Gaps: | 4/65 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 173 DKYDHSYLTENGIYGEEQAKLHHTG----GTHAKGFYEYTGDDGKLYRVNYASNDGGFMPQGDHI 233
|.|.:.:.|.:|...|:...|...| .....|.:.:.||||:.:.::|.:::.||.|||:.|
Fly 35 DSYSYKFETSDGTKQEQHGSLKSLGPEEDALQVAGSFSFVGDDGQTHAISYVADENGFQPQGEDI 99
Fly 234 233
Fly 100 99
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR10380 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.