DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ac and Lcp65Ac

DIOPT Version :10

Sequence 1:NP_725150.2 Gene:Cpr49Ac / 36348 FlyBaseID:FBgn0033725 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_477279.1 Gene:Lcp65Ac / 38708 FlyBaseID:FBgn0020642 Length:109 Species:Drosophila melanogaster


Alignment Length:80 Identity:26/80 - (32%)
Similarity:43/80 - (53%) Gaps:4/80 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 KILHKEEVRKQDKYDHSYLTENGIYGEEQAKLHHTGGTH----AKGFYEYTGDDGKLYRVNYASN 222
            :||..|...:.:.|:.:..|.:|...|||.:|.:.|...    .:|.|.:..|||:.|.|||.::
  Fly    27 QILRLESDVQPEGYNFALETSDGKKHEEQGQLKNVGTEQEAIVVRGSYSFVADDGQTYTVNYIAD 91

  Fly   223 DGGFMPQGDHIHPIP 237
            :.||.|:|.|:..:|
  Fly    92 ENGFQPEGAHLPNVP 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AcNP_725150.2 Chitin_bind_4 175..226 CDD:459790 17/54 (31%)
Lcp65AcNP_477279.1 Chitin_bind_4 40..95 CDD:459790 17/54 (31%)

Return to query results.
Submit another query.