DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ac and Lcp65Ag2

DIOPT Version :10

Sequence 1:NP_725150.2 Gene:Cpr49Ac / 36348 FlyBaseID:FBgn0033725 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_477272.1 Gene:Lcp65Ag2 / 38702 FlyBaseID:FBgn0020637 Length:105 Species:Drosophila melanogaster


Alignment Length:70 Identity:24/70 - (34%)
Similarity:35/70 - (50%) Gaps:6/70 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 KYDHSYLTENGIYGEEQAKLHHTG----GTHAKGFYEYTGDDGKLYRVNYASNDGGFMPQGDHIH 234
            |||  :.|.:|...:...:|:..|    .....|.|.:..|||:.|:|||.::..||.|||.|:.
  Fly    38 KYD--WETSDGQAAQAVGQLNDIGTENEAISVSGSYRFIADDGQTYQVNYIADKNGFQPQGAHLP 100

  Fly   235 PIPDA 239
            ..|.|
  Fly   101 VAPVA 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AcNP_725150.2 Chitin_bind_4 175..226 CDD:459790 15/54 (28%)
Lcp65Ag2NP_477272.1 Chitin_bind_4 37..92 CDD:459790 16/55 (29%)

Return to query results.
Submit another query.