DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ac and Cpr47Ed

DIOPT Version :10

Sequence 1:NP_725150.2 Gene:Cpr49Ac / 36348 FlyBaseID:FBgn0033725 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_610658.1 Gene:Cpr47Ed / 36192 FlyBaseID:FBgn0033601 Length:127 Species:Drosophila melanogaster


Alignment Length:73 Identity:20/73 - (27%)
Similarity:30/73 - (41%) Gaps:11/73 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 YDHSYLTENGIYGEEQAKLHHTGGT-----HAKGFYEYTGDDGKLYRVNYASNDGGFMP------ 228
            |..|:.:.:|.|.||...:.....|     ...|.|.|..|.|:...|.|.::..||:|      
  Fly    43 YLFSFESADGTYREELGIVSSDSKTSDDDLEVSGIYRYINDWGQEVEVRYTADKNGFLPHVRYIS 107

  Fly   229 QGDHIHPI 236
            :|:...||
  Fly   108 KGEAYKPI 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AcNP_725150.2 Chitin_bind_4 175..226 CDD:459790 14/55 (25%)
Cpr47EdNP_610658.1 Chitin_bind_4 43..99 CDD:459790 14/55 (25%)

Return to query results.
Submit another query.