DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ac and CG15756

DIOPT Version :9

Sequence 1:NP_725150.2 Gene:Cpr49Ac / 36348 FlyBaseID:FBgn0033725 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_572895.1 Gene:CG15756 / 32308 FlyBaseID:FBgn0030493 Length:298 Species:Drosophila melanogaster


Alignment Length:202 Identity:41/202 - (20%)
Similarity:72/202 - (35%) Gaps:75/202 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 TKKP-TTTTKRTTTSTTTTTTTPRNILFNYDDEGRHKILH------------------------- 165
            |::| .|||.|:|||.||.         |.|   ||:.:|                         
  Fly    35 TRRPRRTTTPRSTTSITTA---------NPD---RHQHVHHWPPLVAPPPQPQPQPPVVVVQKPS 87

  Fly   166 --KEEVRKQDKYDHSYLTENGIYGEEQAKLHHTGGTHAKGFYEYTGDDGKLYRVNYASNDGGFMP 228
              :...|..|.:|...|  :|.| |.:.:|.:....:.:.::...|.|..|.:..|.|       
  Fly    88 HTETSPRLVDSFDQRSL--DGQY-EFRYQLDNGNTRYERAYWLPVGKDLVLAKKGYYS------- 142

  Fly   229 QGDHIHPIPDAIVRALKYVEEQHKINGGAQFDHRGFRINHMTKDLKAQIKAIHLEEMPKELTEQI 293
                 .|:|:.....:.|..           ||||:.::..|..::..:       :|:.|  ::
  Fly   143 -----VPLPNDKYSTVFYTA-----------DHRGYHVDMQTLSVEQPL-------LPRSL--EV 182

  Fly   294 HMLEHEV 300
            ..:|.:|
  Fly   183 PGVERDV 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AcNP_725150.2 Chitin_bind_4 175..226 CDD:278791 11/50 (22%)
CG15756NP_572895.1 Chitin_bind_4 108..162 CDD:278791 14/77 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.