DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ac and Cpr11B

DIOPT Version :9

Sequence 1:NP_725150.2 Gene:Cpr49Ac / 36348 FlyBaseID:FBgn0033725 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_572807.1 Gene:Cpr11B / 32203 FlyBaseID:FBgn0030398 Length:197 Species:Drosophila melanogaster


Alignment Length:212 Identity:47/212 - (22%)
Similarity:66/212 - (31%) Gaps:93/212 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KYRPSDDGK---YHG-NSQNEGRSGSQESIGRYHHMPIPYRHVSDQRELGKYHHIPYPYDGG--Y 100
            :|.|:....   ||| :.|.:.|.|:..|.|                             ||  |
  Fly    27 RYLPTPQASQLHYHGVSGQGQARPGAGHSFG-----------------------------GGSSY 62

  Fly   101 GPYAGSNIPYVHDDRPYNHDLYTSTTTKKPTTTTKRTTTSTTTTTTTPRNILFNYDDEGRHKILH 165
            .......||.|..|                                      :|.|..|      
  Fly    63 QRQQQPQIPIVRSD--------------------------------------YNSDANG------ 83

  Fly   166 KEEVRKQDKYDHSYLTENGIYGEEQAKLH----HTGGTHAKGFYEYTGDDGKLYRVNYASNDGGF 226
                    .|:..:.|.|||:.:|..:..    | |....:|.|.|||||||.|.|||.::..||
  Fly    84 --------NYNFGFDTGNGIHRDETGEFRGGWPH-GSLGVQGSYSYTGDDGKQYTVNYTADKNGF 139

  Fly   227 MPQGDHIHPIPDAIVRA 243
            ..:|.|: |:..::..|
  Fly   140 HAEGAHL-PVSPSVPAA 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AcNP_725150.2 Chitin_bind_4 175..226 CDD:278791 21/54 (39%)
Cpr11BNP_572807.1 Chitin_bind_4 85..139 CDD:278791 21/54 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439121
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D146314at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.