DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8501 and cd59

DIOPT Version :9

Sequence 1:NP_001286343.1 Gene:CG8501 / 36347 FlyBaseID:FBgn0033724 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001313314.1 Gene:cd59 / 567192 ZFINID:ZDB-GENE-030131-7871 Length:118 Species:Danio rerio


Alignment Length:133 Identity:32/133 - (24%)
Similarity:59/133 - (44%) Gaps:27/133 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ICMVWLVAGLAIGEALRCYECVDQETSCGSADNSPGRVRECPNSTMCSTTMLTTMVNGNEWIRVR 75
            :|:|:::|.|.:|.|::||.|.|...:|       .::::|.....|    |:....|.:   ..
Zfish     7 VCVVFVLALLGLGSAIKCYNCKDYTGAC-------SKIKDCYYDDAC----LSVYERGGD---TY 57

  Fly    76 RGCAKQVDHYFDYIGKHWEQKYRLMDLPEGCKKENGRMNCNCRGELCNSGSHSTPNFRLPFVLIL 140
            |.|.|..:..:..:|         :..|   |..:.:.:| |..:||||...|..:..:..:|:.
Zfish    58 RQCIKYSECDYSTVG---------VKFP---KLSSFKFSC-CTSDLCNSAPLSVSSRSVVAILLP 109

  Fly   141 LAL 143
            |||
Zfish   110 LAL 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8501NP_001286343.1 None
cd59NP_001313314.1 LU 24..95 CDD:299177 21/97 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.