DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ab and Lcp65Ag3

DIOPT Version :10

Sequence 1:NP_610769.1 Gene:Cpr49Ab / 36345 FlyBaseID:FBgn0050042 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_652662.1 Gene:Lcp65Ag3 / 59159 FlyBaseID:FBgn0086611 Length:105 Species:Drosophila melanogaster


Alignment Length:105 Identity:38/105 - (36%)
Similarity:52/105 - (49%) Gaps:18/105 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 APPAIADPTANLPKGRGTGEGGNGWAIIRQEDDVEVDGYHYLWETENGILGEESGRIEKL-TEEE 198
            |.||..:||                 |:|.|.||..:.:.|.|||.:|...:..|::..: ||.|
  Fly    16 AAPAAEEPT-----------------IVRSESDVGPESFKYDWETSDGQAAQAVGQLNDIGTENE 63

  Fly   199 GLRSKGFYEYTGPDGILYRVDYVADDNGFVPSAAHLPTAP 238
            .:...|.|.:...||..|:|:|:||.|||.|..||||.||
  Fly    64 AISVSGSYRFIADDGQTYQVNYIADKNGFQPEGAHLPVAP 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AbNP_610769.1 Chitin_bind_4 173..227 CDD:459790 19/54 (35%)
Lcp65Ag3NP_652662.1 Chitin_bind_4 37..92 CDD:459790 19/54 (35%)

Return to query results.
Submit another query.