DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ab and Cpr65Ax1

DIOPT Version :10

Sequence 1:NP_610769.1 Gene:Cpr49Ab / 36345 FlyBaseID:FBgn0050042 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001097523.1 Gene:Cpr65Ax1 / 5740751 FlyBaseID:FBgn0086900 Length:102 Species:Drosophila melanogaster


Alignment Length:102 Identity:39/102 - (38%)
Similarity:52/102 - (50%) Gaps:16/102 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 AIADPTANLPKGRGTGEGGNGWAIIRQEDDVEVDGYHYLWETENGILGEESGRIEKL-TEEEGLR 201
            |:|.||..               ::|.:.:|.:|.|.|..||.:|....|.|.::.. ||.|.:.
  Fly    14 ALAAPTVE---------------VLRSDSNVGIDNYSYAVETSDGTSKSEEGVLKNAGTELEAIS 63

  Fly   202 SKGFYEYTGPDGILYRVDYVADDNGFVPSAAHLPTAP 238
            :.|.:.|.||||..|.|.||||:|||.|..||||.||
  Fly    64 THGSFSYVGPDGQTYTVTYVADENGFQPQGAHLPVAP 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AbNP_610769.1 Chitin_bind_4 173..227 CDD:459790 23/54 (43%)
Cpr65Ax1NP_001097523.1 Chitin_bind_4 34..89 CDD:459790 23/54 (43%)

Return to query results.
Submit another query.