DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ab and LOC4576766

DIOPT Version :10

Sequence 1:NP_610769.1 Gene:Cpr49Ab / 36345 FlyBaseID:FBgn0050042 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_061499237.1 Gene:LOC4576766 / 4576766 VectorBaseID:AGAMI1_002407 Length:230 Species:Anopheles gambiae


Alignment Length:85 Identity:26/85 - (30%)
Similarity:36/85 - (42%) Gaps:8/85 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 HYLWETENGILGEESGRIEKLTE-EEGLRSKGFYEYTGPDGILYRVDYVAD-DNGFVPSA----- 231
            |..::.|.|:....:|..:...| .:|...||.|.....||....|||.:| .|||....     
Mosquito    31 HPKYKFEYGVKDPHTGDHKTQWEVRDGDVVKGQYTLHEADGTERVVDYKSDGHNGFEADVKKVGH 95

  Fly   232 AHLPTAPPPPPYVEKLLAFL 251
            ||.|:.|...| :..|:|.|
Mosquito    96 AHHPSHPVHAP-ILALIACL 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AbNP_610769.1 Chitin_bind_4 173..227 CDD:459790 16/54 (30%)
LOC4576766XP_061499237.1 None

Return to query results.
Submit another query.