DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ab and Ccp84Ae

DIOPT Version :10

Sequence 1:NP_610769.1 Gene:Cpr49Ab / 36345 FlyBaseID:FBgn0050042 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_649679.1 Gene:Ccp84Ae / 40821 FlyBaseID:FBgn0004779 Length:208 Species:Drosophila melanogaster


Alignment Length:139 Identity:37/139 - (26%)
Similarity:53/139 - (38%) Gaps:39/139 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 TAAPPAIADPTANLPKGRGTGEGGNGWAIIRQEDDVEVD---GYHYLWETENGILGEESGRIEKL 194
            ||||.|:|  :|.:|            .:.:..:..|||   .|.|.::.::.:.|:..|.:|  
  Fly    22 TAAPVAVA--SAPVP------------VLAKTVELEEVDPHPQYTYSYDVQDTLSGDNKGHVE-- 70

  Fly   195 TEEEGLRSKGFYEYTGPDGILYRVDYVADD-NGF------------------VPSAAHLPTAPPP 240
             |.:|...:|.|.....||....|.|.||. |||                  :..||.|..|.|.
  Fly    71 -ERDGDVVRGEYSLIDADGFKRTVTYTADSINGFNAVVRREPLAAVVAAEPLLKVAAPLVKAAPV 134

  Fly   241 PPYVEKLLA 249
            .|.....||
  Fly   135 APIAPVALA 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AbNP_610769.1 Chitin_bind_4 173..227 CDD:459790 16/54 (30%)
Ccp84AeNP_649679.1 Chitin_bind_4 51..103 CDD:459790 16/54 (30%)

Return to query results.
Submit another query.