DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ab and Cpr67Fb

DIOPT Version :10

Sequence 1:NP_610769.1 Gene:Cpr49Ab / 36345 FlyBaseID:FBgn0050042 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_648420.1 Gene:Cpr67Fb / 39225 FlyBaseID:FBgn0036110 Length:122 Species:Drosophila melanogaster


Alignment Length:94 Identity:38/94 - (40%)
Similarity:57/94 - (60%) Gaps:10/94 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 RQEDDVEVDGYHYLWE--TENGILGEESGRIEKLTEEEGLRSKGFYEYTGPDGILYRVDYVADDN 225
            :..::::.|| .|.||  |.|||..:|||       ..|:::.|...|..|||...:::|.||:|
  Fly    28 KYRNEIKPDG-SYSWEYGTSNGIDAQESG-------VGGVQAAGSVSYAAPDGTPIQLEYTADEN 84

  Fly   226 GFVPSAAHLPTAPPPPPYVEKLLAFLEAN 254
            |:.|:.|||||.||.|.|:.|.||::||:
  Fly    85 GYRPTGAHLPTPPPIPDYILKALAYIEAH 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AbNP_610769.1 Chitin_bind_4 173..227 CDD:459790 20/55 (36%)
Cpr67FbNP_648420.1 Chitin_bind_4 39..86 CDD:459790 20/53 (38%)

Return to query results.
Submit another query.