DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ab and Cpr65Eb

DIOPT Version :9

Sequence 1:NP_610769.1 Gene:Cpr49Ab / 36345 FlyBaseID:FBgn0050042 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster


Alignment Length:93 Identity:36/93 - (38%)
Similarity:49/93 - (52%) Gaps:14/93 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 IRQEDDVEVDGYHYLWETENGILGEESGRIEKLTEEEGLRSKGFYEYTGPDGILYRVDYVADDNG 226
            ::|||.:    |:|.:||.|||..:|.|       ..|..:.|..:|..|:|.|.::.|.||:||
  Fly    39 LKQEDGI----YNYQFETSNGIAQQEQG-------VGGYYASGSSQYYTPEGQLIQLTYTADENG 92

  Fly   227 FVPSAAHLPTAPPPPPYVEKLLAFLEAN 254
            |.|...||||   |.|..|.:|..||.|
  Fly    93 FQPQGEHLPT---PHPIPEAILKSLEYN 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AbNP_610769.1 Chitin_bind_4 173..227 CDD:278791 19/53 (36%)
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:278791 19/53 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439131
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.