DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ab and Lcp65Ac

DIOPT Version :10

Sequence 1:NP_610769.1 Gene:Cpr49Ab / 36345 FlyBaseID:FBgn0050042 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_477279.1 Gene:Lcp65Ac / 38708 FlyBaseID:FBgn0020642 Length:109 Species:Drosophila melanogaster


Alignment Length:79 Identity:34/79 - (43%)
Similarity:51/79 - (64%) Gaps:1/79 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 IIRQEDDVEVDGYHYLWETENGILGEESGRIEKL-TEEEGLRSKGFYEYTGPDGILYRVDYVADD 224
            |:|.|.||:.:||::..||.:|...||.|:::.: ||:|.:..:|.|.:...||..|.|:|:||:
  Fly    28 ILRLESDVQPEGYNFALETSDGKKHEEQGQLKNVGTEQEAIVVRGSYSFVADDGQTYTVNYIADE 92

  Fly   225 NGFVPSAAHLPTAP 238
            |||.|..||||..|
  Fly    93 NGFQPEGAHLPNVP 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AbNP_610769.1 Chitin_bind_4 173..227 CDD:459790 20/54 (37%)
Lcp65AcNP_477279.1 Chitin_bind_4 40..95 CDD:459790 20/54 (37%)

Return to query results.
Submit another query.