DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ab and Lcp65Ad

DIOPT Version :10

Sequence 1:NP_610769.1 Gene:Cpr49Ab / 36345 FlyBaseID:FBgn0050042 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_477278.1 Gene:Lcp65Ad / 38707 FlyBaseID:FBgn0020641 Length:108 Species:Drosophila melanogaster


Alignment Length:103 Identity:36/103 - (34%)
Similarity:53/103 - (51%) Gaps:17/103 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 AAPPAIADPTANLPKGRGTGEGGNGWAIIRQEDDVEVDGYHYLWETENGILGEESGRIEKL-TEE 197
            ||||||....                .::|.:.||..:||.:..||.:|...:|.|:::.: |:.
  Fly    18 AAPPAIQQDA----------------QVLRFDSDVLPEGYKFAVETSDGKSHQEEGQLKDVGTDH 66

  Fly   198 EGLRSKGFYEYTGPDGILYRVDYVADDNGFVPSAAHLP 235
            |.:..:|.|.|.|.||..|.:.|:||:|||.|..||||
  Fly    67 EAIVVRGSYAYVGDDGQTYSIQYLADENGFQPEGAHLP 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AbNP_610769.1 Chitin_bind_4 173..227 CDD:459790 19/54 (35%)
Lcp65AdNP_477278.1 Chitin_bind_4 41..96 CDD:459790 19/54 (35%)

Return to query results.
Submit another query.