DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ab and Cpr64Aa

DIOPT Version :10

Sequence 1:NP_610769.1 Gene:Cpr49Ab / 36345 FlyBaseID:FBgn0050042 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_647872.1 Gene:Cpr64Aa / 38508 FlyBaseID:FBgn0035510 Length:192 Species:Drosophila melanogaster


Alignment Length:165 Identity:38/165 - (23%)
Similarity:54/165 - (32%) Gaps:54/165 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 AVVVPRTSARPQPRPTTAAP-----PAIADPTANLPKGRGTGEGGNGWAIIRQEDDVEVDG---- 172
            :.:|..:||...|.|..|.|     ||:|...|.|.                    .:|.|    
  Fly    10 SALVAVSSAVVVPGPGLALPAYPSYPALAKVAAPLV--------------------AKVAGPEPY 54

  Fly   173 -----YHYLWETENGILGEESGRIEKLTEEEGLRSKGFYEYTGPDGILYRVDYVADD-NGF---- 227
                 |.:.::..:|..|:...:.|   ...|...:|.|.....||....|:|.||. :||    
  Fly    55 DPNPQYTFSYDVHDGSTGDVKSQQE---TRSGDVVQGAYSLIEADGTRRIVEYTADPVHGFNAVV 116

  Fly   228 ----------VPSAAHLPTAP--PPPPYVEKLLAF 250
                      .|.|..|..||  ...|.|.|:.|:
  Fly   117 RREGAVVKAVAPVAKVLAPAPLLHASPLVAKVPAY 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AbNP_610769.1 Chitin_bind_4 173..227 CDD:459790 13/54 (24%)
Cpr64AaNP_647872.1 Chitin_bind_4 60..112 CDD:459790 13/54 (24%)

Return to query results.
Submit another query.