DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ab and Lcp9

DIOPT Version :10

Sequence 1:NP_610769.1 Gene:Cpr49Ab / 36345 FlyBaseID:FBgn0050042 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_523854.1 Gene:Lcp9 / 37963 FlyBaseID:FBgn0025578 Length:92 Species:Drosophila melanogaster


Alignment Length:69 Identity:20/69 - (28%)
Similarity:36/69 - (52%) Gaps:3/69 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 IIRQEDDVEVDGYHYLWETENGILGEESGRIEKLTEEEGLRSKGFYEYTGPDGILYRVDYVADDN 225
            :::.:.:|.:..::|.:|..|.|...::|   .|.|.:.....|.|||..|:|...:|.|.||:.
  Fly    22 VVKSDSEVNLLDFNYAYELSNHIRAVQTG---ALKEHDNWVVSGEYEYVAPNGKTVKVVYTADET 83

  Fly   226 GFVP 229
            |:.|
  Fly    84 GYHP 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AbNP_610769.1 Chitin_bind_4 173..227 CDD:459790 17/53 (32%)
Lcp9NP_523854.1 Chitin_bind_4 34..85 CDD:459790 17/53 (32%)

Return to query results.
Submit another query.