DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ab and Cpr49Af

DIOPT Version :10

Sequence 1:NP_610769.1 Gene:Cpr49Ab / 36345 FlyBaseID:FBgn0050042 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_610775.1 Gene:Cpr49Af / 36352 FlyBaseID:FBgn0033729 Length:126 Species:Drosophila melanogaster


Alignment Length:92 Identity:34/92 - (36%)
Similarity:50/92 - (54%) Gaps:2/92 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 IRQEDDVEVDG-YHYLWETENGILGEESGRIEKL-TEEEGLRSKGFYEYTGPDGILYRVDYVADD 224
            |.||.:||.:| |||.:|.::|....:.|.::.: .:..|....|.|.:...||..|.|.|.||:
  Fly    23 ISQESNVEYNGKYHYHYELKDGSKATQDGVLKSVNADHNGESVNGKYSFVADDGKTYVVSYTADE 87

  Fly   225 NGFVPSAAHLPTAPPPPPYVEKLLAFL 251
            ||::....||||.||.|..|.|.|.::
  Fly    88 NGYLAVGDHLPTPPPTPVSVLKALEYI 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AbNP_610769.1 Chitin_bind_4 173..227 CDD:459790 17/54 (31%)
Cpr49AfNP_610775.1 Chitin_bind_4 35..90 CDD:459790 17/54 (31%)

Return to query results.
Submit another query.