DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ab and Cpr49Ad

DIOPT Version :10

Sequence 1:NP_610769.1 Gene:Cpr49Ab / 36345 FlyBaseID:FBgn0050042 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_610773.1 Gene:Cpr49Ad / 36349 FlyBaseID:FBgn0033726 Length:166 Species:Drosophila melanogaster


Alignment Length:74 Identity:31/74 - (41%)
Similarity:41/74 - (55%) Gaps:7/74 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 IIRQEDDVE--VDGYHYLWETENGILGEESG---RIEKLTEEEGLRSKGFYEYTGPDGILYRVDY 220
            |:.|.:||.  ...|.|.:||||||.|||.|   .|....:||  :.:|.|.:..|:|:...|.|
  Fly    69 IVEQNNDVNYGAGSYSYNYETENGIHGEERGVPVNIGNQQQEE--QVEGAYSFITPEGLRVGVKY 131

  Fly   221 VADDNGFVP 229
            :||.|||.|
  Fly   132 LADANGFRP 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AbNP_610769.1 Chitin_bind_4 173..227 CDD:459790 24/56 (43%)
Cpr49AdNP_610773.1 Chitin_bind_4 83..138 CDD:459790 24/56 (43%)

Return to query results.
Submit another query.