DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ab and Cpr47Ec

DIOPT Version :10

Sequence 1:NP_610769.1 Gene:Cpr49Ab / 36345 FlyBaseID:FBgn0050042 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_610657.1 Gene:Cpr47Ec / 36191 FlyBaseID:FBgn0033600 Length:131 Species:Drosophila melanogaster


Alignment Length:96 Identity:33/96 - (34%)
Similarity:45/96 - (46%) Gaps:8/96 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 AIIRQEDDVEVDGYHYLWETENGI-LGEESGRIEKLTEEEGLRSKGFYEYTGPDGILYRVDYVAD 223
            ||::.|.....:||...:...:|| ..||:..::|.|:||.|..||.|:|...||....|.|.|.
  Fly    30 AILKSEIIKTEEGYTSAYVGADGISRNEEAFLVDKGTDEEALEVKGSYKYINEDGQEVEVFYTAG 94

  Fly   224 DNGFV-------PSAAHLPTAPPPPPYVEKL 247
            .||||       |....:..|....|.|||:
  Fly    95 KNGFVPYGSIINPEITAVAEAAKDLPKVEKV 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AbNP_610769.1 Chitin_bind_4 173..227 CDD:459790 20/54 (37%)
Cpr47EcNP_610657.1 Chitin_bind_4 43..98 CDD:459790 20/54 (37%)

Return to query results.
Submit another query.