DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ab and LOC1279521

DIOPT Version :10

Sequence 1:NP_610769.1 Gene:Cpr49Ab / 36345 FlyBaseID:FBgn0050042 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_319249.5 Gene:LOC1279521 / 1279521 VectorBaseID:AGAMI1_002752 Length:247 Species:Anopheles gambiae


Alignment Length:73 Identity:22/73 - (30%)
Similarity:31/73 - (42%) Gaps:8/73 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 AIIRQEDDVEVDG----YHYLWETENGILGEESGRIEKLTEEEGLRSKGFYEYTGPDGILYRVDY 220
            |:::....||...    |.:.::..:...|:...:.|   |..|...||.|.....||....|||
Mosquito    64 ALVKTVKHVEYPDAPAEYQFAYDVHDDHTGDVKSQQE---ERHGDVVKGQYTLIDADGYRRIVDY 125

  Fly   221 VADD-NGF 227
            .||| |||
Mosquito   126 TADDHNGF 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AbNP_610769.1 Chitin_bind_4 173..227 CDD:459790 17/54 (31%)
LOC1279521XP_319249.5 None

Return to query results.
Submit another query.