DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ab and LOC1276668

DIOPT Version :10

Sequence 1:NP_610769.1 Gene:Cpr49Ab / 36345 FlyBaseID:FBgn0050042 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_316038.1 Gene:LOC1276668 / 1276668 VectorBaseID:AGAMI1_010311 Length:104 Species:Anopheles gambiae


Alignment Length:73 Identity:32/73 - (43%)
Similarity:48/73 - (65%) Gaps:1/73 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 QEDDVEVDGYHYLWETENGILGEESGRIEKLTEE-EGLRSKGFYEYTGPDGILYRVDYVADDNGF 227
            :.|::.||||::.:||.|.|...|:..::...:: ..|..:|.|.||||||.:|.|:||||:|||
Mosquito    30 ENDNLGVDGYNFQYETSNNINRAETAELKNFGDDVAALVVRGSYSYTGPDGQVYTVNYVADENGF 94

  Fly   228 VPSAAHLP 235
            .|.|.|:|
Mosquito    95 QPEAPHIP 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AbNP_610769.1 Chitin_bind_4 173..227 CDD:459790 22/54 (41%)
LOC1276668XP_316038.1 Chitin_bind_4 39..94 CDD:459790 22/54 (41%)

Return to query results.
Submit another query.