DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ab and LOC1272964

DIOPT Version :10

Sequence 1:NP_610769.1 Gene:Cpr49Ab / 36345 FlyBaseID:FBgn0050042 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_311895.4 Gene:LOC1272964 / 1272964 VectorBaseID:AGAMI1_008652 Length:200 Species:Anopheles gambiae


Alignment Length:76 Identity:26/76 - (34%)
Similarity:33/76 - (43%) Gaps:6/76 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 RQEDDVEVDGYHYLWETENGILGEESGRIEKLTE-EEGLRSKGFYEYTGPDGILYRVDYVADD-N 225
            |:..|.:.|.|.|.:    .:..|.||.|:...| ..|.|.:|.|.....||....|||.||| .
Mosquito    81 RESSDYDRDDYSYGY----AVRDELSGDIKSQQEVRNGDRVRGQYRTLESDGTERIVDYTADDVR 141

  Fly   226 GFVPSAAHLPT 236
            ||.....|.|:
Mosquito   142 GFNAVVRHQPS 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AbNP_610769.1 Chitin_bind_4 173..227 CDD:459790 19/55 (35%)
LOC1272964XP_311895.4 None

Return to query results.
Submit another query.