DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rhox12 and Drgx

DIOPT Version :9

Sequence 1:NP_001020072.1 Gene:Rhox12 / 363437 RGDID:1563789 Length:175 Species:Rattus norvegicus
Sequence 2:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster


Alignment Length:76 Identity:32/76 - (42%)
Similarity:47/76 - (61%) Gaps:2/76 - (2%)


- Green bases have known domain annotations that are detailed below.


  Rat   101 RRTRPRIQLGLTPRQLSELEDFFETTKYPDVITRRNLAKHLYLAESRVKRWFKRRRARYRKEQ-- 163
            ||.:.|.:...|.:||.|||..|..|.||||.||.:||..:.|.|:||:.||:.|||::||.:  
  Fly    49 RRKQRRNRTTFTLQQLEELETAFAQTHYPDVFTREDLAMKINLTEARVQVWFQNRRAKWRKAERL 113

  Rat   164 QTQMLKRASAD 174
            :.:..||.:.:
  Fly   114 KDEQRKRENGE 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rhox12NP_001020072.1 homeodomain 101..163 CDD:238039 30/61 (49%)
DrgxNP_001097075.2 Homeobox 56..108 CDD:278475 25/51 (49%)
OAR 428..445 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.