DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13160 and Tfrc

DIOPT Version :10

Sequence 1:NP_001260918.1 Gene:CG13160 / 36343 FlyBaseID:FBgn0033720 Length:875 Species:Drosophila melanogaster
Sequence 2:NP_073203.1 Gene:Tfrc / 64678 RGDID:70488 Length:761 Species:Rattus norvegicus


Alignment Length:233 Identity:44/233 - (18%)
Similarity:75/233 - (32%) Gaps:67/233 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 YLLVNSHYDTKPGSPGAGDDAAMVVVMLEVLRLVA--VSGDPF--LHPIIFLFNGAEEQPMQGSH 225
            |::|.:..|.  ..||....:....::|::.::.:  :|.|.|  ...|||....|      |.:
  Rat   403 YIVVGAQRDA--WGPGVAKSSVGTGLLLKLAQVFSDMISKDGFRPSRSIIFASWTA------GDY 459

  Fly   226 GFITQHRW------AANCKAL--LNLDSAGAGGRDLLFQGGPNHPWLMEHYRNSAPHPFATTTAE 282
            |.:....|      :.:.||.  :|||....|..:......|....||........||       
  Rat   460 GAVGATEWLEGYLSSLHLKAFTYINLDKVVLGTSNFKVSASPLLYTLMGKIMQDVKHP------- 517

  Fly   283 EMFEAGIIPSDTDF-----RIFRDFGVVPGLDMAGV--------------YNGFVYHTKFDRYAV 328
              .:...:..|:::     .:..|....|.|..:|:              |.|    ||.|.|.:
  Rat   518 --IDGKYLYRDSNWISKIEELSLDNAAFPFLAYSGIPAVSFCFCEDEDYPYLG----TKLDTYEI 576

  Fly   329 ISLDSLQNSGDNLLALVWSISNAEEMYDTEAHAAGHAV 366
                           |:..:....:|..|.|..||..:
  Rat   577 ---------------LIQKVPQLNQMVRTAAEVAGQFI 599

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13160NP_001260918.1 M28_Fxna_like 71..378 CDD:349872 44/233 (19%)
TfrcNP_073203.1 Mediates interaction with SH3BP4. /evidence=ECO:0000250|UniProtKB:P02786 1..67
Endocytosis signal. /evidence=ECO:0000250|UniProtKB:P02786 20..23
Stop-transfer sequence. /evidence=ECO:0000250|UniProtKB:P02786 58..61
PA_TfR 201..378 CDD:239043
M28_TfR 386..611 CDD:349946 44/233 (19%)
Ligand-binding. /evidence=ECO:0000250 570..761 9/45 (20%)
TFR_dimer 638..751 CDD:461238
Cell attachment site, required for binding to transferrin. /evidence=ECO:0000250|UniProtKB:P02786 647..649
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.