DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13160 and CPQ

DIOPT Version :10

Sequence 1:NP_001260918.1 Gene:CG13160 / 36343 FlyBaseID:FBgn0033720 Length:875 Species:Drosophila melanogaster
Sequence 2:NP_057218.1 Gene:CPQ / 10404 HGNCID:16910 Length:472 Species:Homo sapiens


Alignment Length:106 Identity:20/106 - (18%)
Similarity:34/106 - (32%) Gaps:34/106 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 LLQNDGHSAKFTYNWRT------------GADRPVLRGGPLKTKYLFDQFHFHWGVNSTVGSEH- 224
            :|...|..:..|.|:..            .|.|.|.||..|            :|..::...|. 
Human   156 MLMGGGVCSTVTLNFNMPGAFVHEVMVVGSAGRLVARGADL------------YGQKNSAAQEEL 208

  Fly   225 -VYDY--------QRYPMEIHLVFYNGLYESFAAAREQVDG 256
             |.|.        ::.|.::.|::..|:.....|.|:...|
Human   209 LVRDSLAVGAGLPEQGPQDVPLLYLKGMVYMVQALRQSFQG 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13160NP_001260918.1 M28_Fxna_like 71..378 CDD:349872 20/106 (19%)
CPQNP_057218.1 M28_Pgcp_like 42..449 CDD:349879 20/106 (19%)

Return to query results.
Submit another query.