DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33012 and TRE2

DIOPT Version :9

Sequence 1:NP_788335.2 Gene:CG33012 / 36342 FlyBaseID:FBgn0053012 Length:912 Species:Drosophila melanogaster
Sequence 2:NP_014899.1 Gene:TRE2 / 854430 SGDID:S000005782 Length:809 Species:Saccharomyces cerevisiae


Alignment Length:166 Identity:30/166 - (18%)
Similarity:60/166 - (36%) Gaps:27/166 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 MEVDVQRSSGSFLHWQMINMYQGIQNVVVKLSSKSSNSTSYLLVNSHYDSKPSSVGTGDAELMVV 221
            ::||:|.:         :.....|.|:|.|:..:..:..:.::..|.   ...:.||........
Yeast   409 IDVDLQTN---------VREKHFIPNIVGKIEGREQSDKAIIIAASR---NSINFGTTYPNFGTA 461

  Fly   222 TMLETLRLMATSEETF----LHPIVFLFNGAEEQPFHGSHSFISNHRWSANCK--ALVNLDSAGA 280
            .:|..::|....:..|    |..|.|:..|..|..:.||...:.........:  :|:::...|.
Yeast   462 ALLSIVQLFQEVKYKFGWKPLRNIYFISFGGTEFNYAGSSELVEQRLTPLKDEIYSLIDISQLGI 526

  Fly   281 GGREILFQGG--------PNHPWLMKQYKKSAKHPF 308
            ...| .::.|        ..||.|.|.:.::|...|
Yeast   527 PFAE-KYENGKTRGELSIETHPLLKKFFNRNAHGNF 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33012NP_788335.2 M28_Fxna_like 103..410 CDD:193497 30/166 (18%)
TRE2NP_014899.1 PA 249..392 CDD:238300
M28_PMSA_TfR_like 417..643 CDD:349871 27/149 (18%)
TFR_dimer 668..799 CDD:398094
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.