DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33012 and VPS70

DIOPT Version :9

Sequence 1:NP_788335.2 Gene:CG33012 / 36342 FlyBaseID:FBgn0053012 Length:912 Species:Drosophila melanogaster
Sequence 2:NP_012660.1 Gene:VPS70 / 853590 SGDID:S000003887 Length:811 Species:Saccharomyces cerevisiae


Alignment Length:383 Identity:76/383 - (19%)
Similarity:132/383 - (34%) Gaps:103/383 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 AQRAESILIRLDLMGPKIAGDYVTEVEMVEFLLGEISKVRDEMRNDLYDMEVDVQRSSGSF---- 168
            |:..:.||.||:..|               |.:|..|.::|                .|||    
Yeast   372 ARDVQPILERLNGRG---------------FQIGPGSNIKD----------------FGSFTGPS 405

  Fly   169 -------LHWQMINMYQGIQNVVVKLSSKSSNSTSYLLVNSHYDSKPSSVGTGDAELMVVTMLET 226
                   ||.::....:.:.:|.|.:....:...  :::.:|.||..|| ..|||......:||.
Yeast   406 SSIDKVHLHNELTYNIKEMSSVEVSIPGIFTEGE--IIIGAHRDSLASS-SAGDANSGSAILLEI 467

  Fly   227 LRLMATSEE---TFLHPIVFLFNGAEEQPFHGSHSFISNHRWSANCKALV--NLDSAGAGG---- 282
            .|.|:...:   ..|.||..:....|.....||..:...|......:|||  |||:|.:|.    
Yeast   468 ARGMSKLLKHGWKPLRPIKLISWDGERSGLLGSTDYAEAHAAILRRRALVYLNLDNAISGTNFHC 532

  Fly   283 ------REILFQGGP------NHPWLMKQYKKSAKHPFATTMAEEIFQADLIPSDTDFRIFRDFG 335
                  ::::::...      :..|.:..:.|...:  ||     |...|.:.|.|.|:....  
Yeast   533 KANPLLQDVIYEAAKLTEFNGHEDWSLFDHWKYTSN--AT-----ISLLDGLSSYTSFQYHLG-- 588

  Fly   336 PVPGLDM---AGCYNGFVYHTK--FDR-----------YKVISRGALQNTGDNVLSLVRSISNAE 384
             ||....   |...:|.|||:.  ||.           ||      |.||....:.|...:.:..
Yeast   589 -VPAAHFQFNANDTSGAVYHSNSVFDSPTWLEKFTNSDYK------LHNTMAMFVGLTTLMLSEN 646

  Fly   385 EMYDTEAHSEGHSVFFDYLGLFFVYYTESTGTALNISFSLGAILVICLSLWRMAKVTD 442
            |:.....|     |:...:..:::.:..:..:|......:.::....|.|.::|...|
Yeast   647 ELARFNTH-----VYLKKIYNWYIAWHSNLSSAFPQDDEVNSLAKRVLDLLKVATQED 699

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33012NP_788335.2 M28_Fxna_like 103..410 CDD:193497 71/349 (20%)
VPS70NP_012660.1 Zinc_peptidase_like 135..>187 CDD:417508
PA_GCPII_like 187..413 CDD:239036 13/71 (18%)
M28_PMSA_TfR_like 419..649 CDD:349871 54/248 (22%)
TFR_dimer <731..799 CDD:398094
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.