DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33012 and APE3

DIOPT Version :9

Sequence 1:NP_788335.2 Gene:CG33012 / 36342 FlyBaseID:FBgn0053012 Length:912 Species:Drosophila melanogaster
Sequence 2:NP_009845.2 Gene:APE3 / 852589 SGDID:S000000490 Length:537 Species:Saccharomyces cerevisiae


Alignment Length:237 Identity:46/237 - (19%)
Similarity:89/237 - (37%) Gaps:36/237 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 QNVVVKLSSKSSNSTSYLLVNSHYDSKPSSVGTGDAELMVVTMLETLRLMATSEETFLHPIVFLF 245
            ||::.  .:|..:..:.:.:.:|.||.....|..|.....:::|...:.:  :.....:.:.|.:
Yeast   294 QNIIA--DTKHGDPDNIVALGAHSDSVEEGPGINDDGSGTISLLNVAKQL--THFKINNKVRFAW 354

  Fly   246 NGAEEQPFHGSHSFISNHRWSANCKALVNLDSAGAGGREILFQGGPNHPWLM-----KQYKKSA- 304
            ..|||:...||:.:..|.....|.|..|.:|..        ....||:.:.:     |:..|.: 
Yeast   355 WAAEEEGLLGSNFYAYNLTKEENSKIRVFMDYD--------MMASPNYEYEIYDANNKENPKGSE 411

  Fly   305 --KHPFATTMAEEIFQADLIPSD--TDFRIFRDFGPVP------GLDMAGCYNGFV----YHTKF 355
              |:.:............|:|.|  :|:..|.:.| :|      |.:.....||.|    ||...
Yeast   412 ELKNLYVDYYKAHHLNYTLVPFDGRSDYVGFINNG-IPAGGIATGAEKNNVNNGKVLDRCYHQLC 475

  Fly   356 DRYKVISRGALQNTGDNVLSLVRSISNAEEMY---DTEAHSE 394
            |....:|..|.......:...|.:.:::.|.:   :|:.|.|
Yeast   476 DDVSNLSWDAFITNTKLIAHSVATYADSFEGFPKRETQKHKE 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33012NP_788335.2 M28_Fxna_like 103..410 CDD:193497 46/237 (19%)
APE3NP_009845.2 M28_SGAP_like 78..506 CDD:349873 42/224 (19%)
PA_ScAPY_like 155..284 CDD:239045
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.