DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33012 and AT4G07670

DIOPT Version :10

Sequence 1:NP_788335.2 Gene:CG33012 / 36342 FlyBaseID:FBgn0053012 Length:912 Species:Drosophila melanogaster
Sequence 2:NP_192510.1 Gene:AT4G07670 / 826236 AraportID:AT4G07670 Length:280 Species:Arabidopsis thaliana


Alignment Length:239 Identity:43/239 - (17%)
Similarity:73/239 - (30%) Gaps:96/239 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   699 GSISLEDSG--YYFDLQDRRFENPLLDKINLTGITRVDDYCKTEMYCGLPCFNHRWCSAVNDARW 761
            |::.:...|  |..|:.:..:|         .|...|..|.....|.|     ..|..|   ::|
plant    34 GAVVIARYGQIYKVDIVNNAYE---------AGAVGVVIYTNKRDYGG-----DEWFPA---SKW 81

  Fly   762 LP------------------------------RDEPVDLPG-TPIL----------QFLNKTVLG 785
            :|                              .||.|:|.| .|::          :.:.||::|
plant    82 MPPSGFQVGTVYNGLGDPTTPGWASVDGCERLSDEAVELSGDVPLIPSLPVSAADAEVILKTIVG 146

  Fly   786 TESAPRALYYFVVSSGPPRMSFFVQPRDGVRMLSWSFLK-----GMLDNPSVYKPPYHIFFGYGS 845
            .           |..||           |:..||:...|     |:::...  :|..::......
plant   147 D-----------VGPGP-----------GILNLSYIVTKIQNVIGVIEGEE--EPDRYVILRNHR 187

  Fly   846 DDSPVEFYFEMTKDDGNFDGPVVELGISGHYMSHLSKRDATTQK 889
            |.      :.....|.| .|..|.:..|..|:.|:::|....||
plant   188 DT------WTFRAVDPN-SGTAVLMEASKSYLQHIAQRLDKLQK 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33012NP_788335.2 M28_Fxna_like 103..410 CDD:349872
AT4G07670NP_192510.1 PA <10..150 CDD:333703 24/143 (17%)
Zinc_peptidase_like <163..>248 CDD:472712 14/71 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.