DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33012 and TFRC

DIOPT Version :9

Sequence 1:NP_788335.2 Gene:CG33012 / 36342 FlyBaseID:FBgn0053012 Length:912 Species:Drosophila melanogaster
Sequence 2:NP_001121620.1 Gene:TFRC / 7037 HGNCID:11763 Length:760 Species:Homo sapiens


Alignment Length:345 Identity:68/345 - (19%)
Similarity:123/345 - (35%) Gaps:78/345 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 YPLFNHLPTGVKIEEEANLPG----TFVAQRAESILIRLDLMGPKIAGDYVTEVEMVEFLLGEIS 144
            :|.|||  |.......:.||.    |.....||.:...::...|   .|:.|: .....:..|..
Human   313 FPSFNH--TQFPPSRSSGLPNIPVQTISRAAAEKLFGNMEGDCP---SDWKTD-STCRMVTSESK 371

  Fly   145 KVRDEMRNDLYDMEVDVQRSSGSFLHWQMINMYQGIQNVVVKLSSKSSNSTSYLLVNSHYDSKPS 209
            .|:..:.|.|.::::              :|::..|:..|        ....|::|.:..|    
Human   372 NVKLTVSNVLKEIKI--------------LNIFGVIKGFV--------EPDHYVVVGAQRD---- 410

  Fly   210 SVGTGDAELMVVTMLETLRLMATSEETFL-------HPIVFLFNGAEEQPFHGSHSFISNHRWSA 267
            :.|.|.|:..|.|.| .|:|.....:..|       ..|:|....|.:....|:..::..:..|.
Human   411 AWGPGAAKSGVGTAL-LLKLAQMFSDMVLKDGFQPSRSIIFASWSAGDFGSVGATEWLEGYLSSL 474

  Fly   268 NCKAL--VNLDSAGAGGREILFQGGPNHPWLMKQYKKSAKHPFATTMAEEIFQ-------ADLIP 323
            :.||.  :|||.|..|.........|....|:::..::.|||   ...:.::|       .:.:.
Human   475 HLKAFTYINLDKAVLGTSNFKVSASPLLYTLIEKTMQNVKHP---VTGQFLYQDSNWASKVEKLT 536

  Fly   324 SDTDFRIFRDFGPVPGLDMAGC------YNGFVYHTKFDRYK----------VISRGALQNTGDN 372
            .|.....|..:..:|.:....|      |.|    |..|.||          .::|.|.:..|..
Human   537 LDNAAFPFLAYSGIPAVSFCFCEDTDYPYLG----TTMDTYKELIERIPELNKVARAAAEVAGQF 597

  Fly   373 VLSLVRSIS-NAE-EMYDTE 390
            |:.|...:. |.: |.|:::
Human   598 VIKLTHDVELNLDYERYNSQ 617

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33012NP_788335.2 M28_Fxna_like 103..410 CDD:193497 62/326 (19%)
TFRCNP_001121620.1 Mediates interaction with SH3BP4. /evidence=ECO:0000269|PubMed:16325581 1..67
Endocytosis signal. /evidence=ECO:0000269|PubMed:2298808 20..23
Stop-transfer sequence. /evidence=ECO:0000303|PubMed:6090955 58..61
PA_TfR 201..377 CDD:239043 15/69 (22%)
M28_TfR 385..610 CDD:193572 49/258 (19%)
Ligand-binding 569..760 11/49 (22%)
TFR_dimer 642..750 CDD:282153
Cell attachment site, required for binding to transferrin 646..648
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.