DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33012 and Tfrc

DIOPT Version :9

Sequence 1:NP_788335.2 Gene:CG33012 / 36342 FlyBaseID:FBgn0053012 Length:912 Species:Drosophila melanogaster
Sequence 2:NP_073203.1 Gene:Tfrc / 64678 RGDID:70488 Length:761 Species:Rattus norvegicus


Alignment Length:345 Identity:68/345 - (19%)
Similarity:123/345 - (35%) Gaps:78/345 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 YPLFNHLPTGVKIEEEANLPG----TFVAQRAESILIRLDLMG---PKIAGDYVTEVEMVEFLLG 141
            :|.|||  |.....:.:.||.    |.....||.:...::  |   |....|...::|     |.
  Rat   314 FPSFNH--TQFPPSQSSGLPSIPVQTISRAAAEKLFKNME--GNCPPSWNIDSSCKLE-----LS 369

  Fly   142 EISKVRDEMRNDLYDMEVDVQRSSGSFLHWQMINMYQGIQNVVVKLSSKSSNSTSYLLVNSHYDS 206
            :...|:..:.|.|.:..:              :|::..|:..        .....|::|.:..|:
  Rat   370 QNQNVKLTVNNVLKETRI--------------LNIFGVIKGY--------EEPDRYIVVGAQRDA 412

  Fly   207 -----KPSSVGTGDAELMVVTMLETLRLMATSEETF--LHPIVFLFNGAEEQPFHGSHSFISNHR 264
                 ..||||||    :::.:.:....| .|::.|  ...|:|....|.:....|:..::..:.
  Rat   413 WGPGVAKSSVGTG----LLLKLAQVFSDM-ISKDGFRPSRSIIFASWTAGDYGAVGATEWLEGYL 472

  Fly   265 WSANCKAL--VNLDSAGAGGREILFQGGPNHPWLMKQYKKSAKHP----FATTMAEEIFQADLIP 323
            .|.:.||.  :|||....|.........|....||.:..:..|||    :....:..|.:.:.:.
  Rat   473 SSLHLKAFTYINLDKVVLGTSNFKVSASPLLYTLMGKIMQDVKHPIDGKYLYRDSNWISKIEELS 537

  Fly   324 SDTDFRIFRDFGPVPGLDMAGC------YNGFVYHTKFDRYKVI----------SRGALQNTGDN 372
            .|.....|..:..:|.:....|      |.|    ||.|.|:::          .|.|.:..|..
  Rat   538 LDNAAFPFLAYSGIPAVSFCFCEDEDYPYLG----TKLDTYEILIQKVPQLNQMVRTAAEVAGQF 598

  Fly   373 VLSLVRSISNA--EEMYDTE 390
            ::.|...|...  .|||:::
  Rat   599 IIKLTHDIELTLDYEMYNSK 618

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33012NP_788335.2 M28_Fxna_like 103..410 CDD:193497 62/326 (19%)
TfrcNP_073203.1 Mediates interaction with SH3BP4. /evidence=ECO:0000250|UniProtKB:P02786 1..67
Endocytosis signal. /evidence=ECO:0000250|UniProtKB:P02786 20..23
Stop-transfer sequence. /evidence=ECO:0000250|UniProtKB:P02786 58..61
PA_TfR 201..378 CDD:239043 16/72 (22%)
M28_TfR 386..611 CDD:349946 47/255 (18%)
Ligand-binding. /evidence=ECO:0000250 570..761 11/49 (22%)
TFR_dimer 638..751 CDD:398094
Cell attachment site, required for binding to transferrin. /evidence=ECO:0000250|UniProtKB:P02786 647..649
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.