DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33012 and Tfr2

DIOPT Version :9

Sequence 1:NP_788335.2 Gene:CG33012 / 36342 FlyBaseID:FBgn0053012 Length:912 Species:Drosophila melanogaster
Sequence 2:XP_030110515.1 Gene:Tfr2 / 50765 MGIID:1354956 Length:840 Species:Mus musculus


Alignment Length:266 Identity:59/266 - (22%)
Similarity:94/266 - (35%) Gaps:83/266 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 LLVNSHYDSKPSS------------------------VGTGDAELMVVT--MLETLRLMATSEET 236
            |:||:|..|.|.|                        .|.|.|:..|.|  :||.:|..::....
Mouse   436 LVVNNHRVSTPISNIFACIEGFAEPDHYVVIGAQRDAWGPGAAKSAVGTAILLELVRTFSSMVSN 500

  Fly   237 FLHP---IVFLFNGAEEQPFHGSHSFISNHRWSANCKAL--VNLDSAGAGG-------------- 282
            ...|   ::|:.....:....|:..::..:....:.||:  |:||::..|.              
Mouse   501 GFRPRRSLLFISWDGGDFGSVGATEWLEGYLSVLHLKAVVYVSLDNSVLGDGKFHAKTSPLLVSL 565

  Fly   283 -REILFQ-GGPNHPWLMKQYKKSAKHPFATTMAEEIFQADLIPSDTDFRIFRDFGPVPGLDMAGC 345
             ..||.| ..|||.......:.:..||   :...|:.|.  :|.|:....|..|..||.::.:..
Mouse   566 IENILKQVDSPNHSGQTLYEQVALTHP---SWDAEVIQP--LPMDSSAYSFTAFAGVPAVEFSFM 625

  Fly   346 YNGFVY---HTKFDRYKVIS---RGAL--------QNTG--------DNVLSL---------VRS 379
            .:..||   |||.|.|:.:.   ||.|        |..|        |::|.|         :|.
Mouse   626 EDDRVYPFLHTKEDTYENLHKMLRGRLPAVVQAVAQLAGQLLIRLSHDHLLPLDFGRYGDVVLRH 690

  Fly   380 ISNAEE 385
            |.|..|
Mouse   691 IGNLNE 696

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33012NP_788335.2 M28_Fxna_like 103..410 CDD:193497 59/266 (22%)
Tfr2XP_030110515.1 PA_TfR 248..438 CDD:239043 1/1 (100%)
M28_TfR 446..679 CDD:349946 49/237 (21%)
TFR_dimer 706..830 CDD:367885
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.