Sequence 1: | NP_788335.2 | Gene: | CG33012 / 36342 | FlyBaseID: | FBgn0053012 | Length: | 912 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_030110515.1 | Gene: | Tfr2 / 50765 | MGIID: | 1354956 | Length: | 840 | Species: | Mus musculus |
Alignment Length: | 266 | Identity: | 59/266 - (22%) |
---|---|---|---|
Similarity: | 94/266 - (35%) | Gaps: | 83/266 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 198 LLVNSHYDSKPSS------------------------VGTGDAELMVVT--MLETLRLMATSEET 236
Fly 237 FLHP---IVFLFNGAEEQPFHGSHSFISNHRWSANCKAL--VNLDSAGAGG-------------- 282
Fly 283 -REILFQ-GGPNHPWLMKQYKKSAKHPFATTMAEEIFQADLIPSDTDFRIFRDFGPVPGLDMAGC 345
Fly 346 YNGFVY---HTKFDRYKVIS---RGAL--------QNTG--------DNVLSL---------VRS 379
Fly 380 ISNAEE 385 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG33012 | NP_788335.2 | M28_Fxna_like | 103..410 | CDD:193497 | 59/266 (22%) |
Tfr2 | XP_030110515.1 | PA_TfR | 248..438 | CDD:239043 | 1/1 (100%) |
M28_TfR | 446..679 | CDD:349946 | 49/237 (21%) | ||
TFR_dimer | 706..830 | CDD:367885 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2234 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |