DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33012 and naalad2

DIOPT Version :9

Sequence 1:NP_788335.2 Gene:CG33012 / 36342 FlyBaseID:FBgn0053012 Length:912 Species:Drosophila melanogaster
Sequence 2:NP_956571.1 Gene:naalad2 / 393247 ZFINID:ZDB-GENE-040426-1025 Length:745 Species:Danio rerio


Alignment Length:298 Identity:47/298 - (15%)
Similarity:101/298 - (33%) Gaps:88/298 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SEHSDTSYTENKKNTVQLVTDGIDPEEGCSNVTLIELKQKSRFSKQLEWYYSPAYLLFWVGLFFA 81
            |.|...::.|..|..:..:..|.|.|.....:.:...:.:...:::.|.|.|             
Zfish   483 SWHKRDNWPEKDKPWISKLGSGSDFEAYFIRLGITSGRARYTKNRKTERYSS------------- 534

  Fly    82 VCYPLFNHL------------PTGVKIEEEANLPGTFVAQRAESILIRLDLMGPKIAGDYVTEVE 134
              ||:::.:            |...::|..|.:.|..:...|:|.::.||.:      :|.|.:.
Zfish   535 --YPVYHSVYETYEIVERFYDPRFRRLEAVARVRGGLIFSLADSAVLPLDCV------EYATSLS 591

  Fly   135 MVEFLLGEISKVRDEMRNDLYDMEVDVQRSSGSFLHWQMINMYQGIQNVVVKLSSKSSNSTSYLL 199
            .....:.:::|...|                             .:|..||...|..|.:.::.:
Zfish   592 TYANSIHQLAKKHPE-----------------------------AMQQYVVSFDSLFSAAENFTV 627

  Fly   200 VNSHYDSKPSSVGTGDAELMVVTMLETLRLMATSEETFLHPIVFLFNGAEEQPFH-------GSH 257
            ....:..:...:.:.:|  :.|.|:.. :||.. |..|:.|:     |...:||:       .||
Zfish   628 AARDFHQRLDQLDSSNA--LAVRMVND-QLMYL-ERAFIDPL-----GLPGRPFYRHIIFAPSSH 683

  Fly   258 SFISNHRWSANCKALVNLDSAGAGGREILFQGGPNHPW 295
            :..:...:.....||.::::|..          |.:.|
Zfish   684 NKYAGESFPGIYDALFDIENAAE----------PENAW 711

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33012NP_788335.2 M28_Fxna_like 103..410 CDD:193497 32/200 (16%)
naalad2NP_956571.1 Zinc_peptidase_like 47..>102 CDD:301362
PA_GCPII_like 108..333 CDD:239036
M28_PSMA_like 341..581 CDD:193568 18/112 (16%)
TFR_dimer 618..733 CDD:282153 19/113 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.