DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33012 and Naalad2

DIOPT Version :9

Sequence 1:NP_788335.2 Gene:CG33012 / 36342 FlyBaseID:FBgn0053012 Length:912 Species:Drosophila melanogaster
Sequence 2:NP_001100272.1 Gene:Naalad2 / 300384 RGDID:1305872 Length:778 Species:Rattus norvegicus


Alignment Length:375 Identity:76/375 - (20%)
Similarity:116/375 - (30%) Gaps:109/375 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 LHWQMINMYQGIQNVVVKLSSKSSNSTSYLLVNSHYDS------KPSSVGTGDAELMVVTMLETL 227
            :|...||....|.||:..:.. |:....|:::..|.||      .|:   ||.|.|.     |..
  Rat   372 MHVHNINKITRIYNVIGTIRG-STEPDRYVILGGHRDSWVFGGIDPT---TGTAVLQ-----EIA 427

  Fly   228 RLMATSEETFLHP---IVFLFNGAEEQPFHGSHSFISNHRWS-ANCK-------ALVNLDSAGAG 281
            |...........|   |:|....|||      ...:.:..|: .|.|       |.:|.|||..|
  Rat   428 RSFGKLVNGGWKPRRTIIFASWDAEE------FGLLGSTEWAEENAKILQERSIAYINSDSAIEG 486

  Fly   282 GREILFQGGPNHPWLMKQYKKSAKHP----FATTMAEEIFQADLIP------------SDTDFR- 329
            ...:.....|....|:.:..:....|    .:.::.|...:.|..|            |.:||. 
  Rat   487 NYTLRVDCTPLLHQLVYKVAREISSPDDGFESKSLYESWLEKDPSPENKERPRINKLGSGSDFEA 551

  Fly   330 IFRDFGPVPG---------LDMAGCYNGFVYHTKFDRYKVIS----------------RGAL--- 366
            .|:..|...|         .|....|.  ||||.::.::::.                ||||   
  Rat   552 YFQRLGIASGRARYTKNKKTDKYSSYP--VYHTIYETFELVQNFYDPTFKKQLSVAQLRGALVYE 614

  Fly   367 -----------QNTGDNVLSLVRSISNAEEMYDTEAHSEGHSVFFDYLGLFFVYYTESTGTALNI 420
                       |:....:.:...||.|..:.:|.:...  |.|.||.|......::|:..     
  Rat   615 LADCVVIPFNIQDYAKALKNYAASIFNLSKKHDQQLRD--HGVSFDPLFSAVKNFSEAAS----- 672

  Fly   421 SFSLGAILVICLSLWRMAKVTDRRLGTYARAFGMQFLLAILGFLLALGFP 470
                        ...|.....|....|..|....|.:|....|:..||.|
  Rat   673 ------------DFHRRLTQVDLNNPTAVRIMNDQQMLLERAFIDPLGLP 710

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33012NP_788335.2 M28_Fxna_like 103..410 CDD:193497 65/313 (21%)
Naalad2NP_001100272.1 Zinc_peptidase_like 86..>143 CDD:417508
PA_GCPII_like 148..374 CDD:239036 0/1 (0%)
M28_PSMA_like <382..623 CDD:349942 52/257 (20%)
TFR_dimer 655..774 CDD:398094 15/73 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.