DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33012 and Tfr2

DIOPT Version :9

Sequence 1:NP_788335.2 Gene:CG33012 / 36342 FlyBaseID:FBgn0053012 Length:912 Species:Drosophila melanogaster
Sequence 2:XP_006249178.1 Gene:Tfr2 / 288562 RGDID:1310152 Length:838 Species:Rattus norvegicus


Alignment Length:368 Identity:77/368 - (20%)
Similarity:130/368 - (35%) Gaps:106/368 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 LLVNSHYDSKPSS------------------------VGTGDAELMVVT--MLETLRLMATSEET 236
            |:||:|..|.|.|                        .|.|.|:..|.|  :||.:|..::...:
  Rat   434 LVVNNHRTSTPISNIFACIEGFAEPDHYVVIGAQRDAWGPGAAKSAVGTAILLELVRTFSSMVSS 498

  Fly   237 FLHP---IVFLFNGAEEQPFHGSHSFISNHRWSANCKAL--VNLDSAGAGG-------------- 282
            ...|   ::|:.....:....|:..::..:....:.||:  |:||::..|.              
  Rat   499 GFRPRRSLLFISWDGGDFGSVGATEWLEGYLSVLHLKAVVYVSLDNSVLGDGKFHAKTSPLLVSL 563

  Fly   283 -REILFQ-GGPNHPWLMKQYKKSAKHPFATTMAEEIFQADLIPSDTDFRIFRDFGPVPGLDMAGC 345
             ..||.| ..|||.......:.:..||   :...|:.|.  :|.|:....|..|..||.::.:..
  Rat   564 IENILKQVDSPNHSGQTLYDQVAFTHP---SWDAEVIQP--LPMDSSAYSFTAFAGVPAVEFSFM 623

  Fly   346 YNGFVY---HTKFDRYKVIS---RGAL--------QNTG--------DNVLSL---------VRS 379
            .:..||   |||.|.|:.:.   ||.|        |..|        |::|.|         :|.
  Rat   624 EDDRVYPFLHTKEDTYENLHKMLRGRLPAVVLAVAQLAGQLLIRLSHDHLLPLDFGRYGDVVLRH 688

  Fly   380 ISNAEEMYDTEAHSEGHSVFFDYLGLFFVYYTESTGTALNISFSLGAILVICLSLWRMAKVTDRR 444
            |.|..| :..:..:.|       |.|.:||  .:.|..:..:..|...:.       .::.:|.|
  Rat   689 IGNLNE-FSGDLKARG-------LTLQWVY--SARGDYIRAAEKLRKEIY-------SSEQSDER 736

  Fly   445 LGTYARAFGMQFLLAILGFLLALGFPL---LMSVFYDAGDRTM 484
            |   .|.:.::.:.....||.....|.   ...:|...||.|:
  Rat   737 L---MRMYNVRIMRVEFYFLSQYVSPADSPFRHIFLGQGDHTL 776

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33012NP_788335.2 M28_Fxna_like 103..410 CDD:193497 63/289 (22%)
Tfr2XP_006249178.1 PA_TfR 246..436 CDD:239043 1/1 (100%)
M28_TfR 444..677 CDD:193572 49/237 (21%)
TFR_dimer 709..828 CDD:282153 15/80 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.