DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33012 and NAALADL2

DIOPT Version :9

Sequence 1:NP_788335.2 Gene:CG33012 / 36342 FlyBaseID:FBgn0053012 Length:912 Species:Drosophila melanogaster
Sequence 2:XP_011510914.1 Gene:NAALADL2 / 254827 HGNCID:23219 Length:805 Species:Homo sapiens


Alignment Length:393 Identity:72/393 - (18%)
Similarity:137/393 - (34%) Gaps:129/393 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NMEK--HNGGFEEDKL--SEHSDTSYTENKKNTVQLVTDGIDPEEGCSNVTLIELKQKSRFSKQL 63
            :|||  ...||::.:|  :|:.:..::|    |:.|..|.|.|          ....|.||.:..
Human    61 DMEKELEESGFDQFQLDGAENQNLGHSE----TIDLNLDSIQP----------ATSPKGRFQRLQ 111

  Fly    64 E-----WYYS-------------------PAYLLFWVGLFFAVCYPLFNHLPTGVKIEEEANLPG 104
            |     .:|:                   .|.:||..|:.  :.|.:..:.|:      :|...|
Human   112 EESDYITHYTRSAPKSNRCNFCHVLKILCTATILFIFGIL--IGYYVHTNCPS------DAPSSG 168

  Fly   105 TFVAQRAESILIRLDLMGPKIAGDYVTEVEMVEFLLGEISKVRDEMRN--DLYDMEVDVQRSSGS 167
            |...|..:.||..:                       :...::...||  .||..|.|::.|...
Human   169 TVDPQLYQEILKTI-----------------------QAEDIKKSFRNLVQLYKNEDDMEISKKI 210

  Fly   168 FLHWQMINMYQGIQ--NVVVKLSSKSSNSTSYLLVNS----HYDSKP------------------ 208
            ...|..:.: :.:|  |..|.|.....:.::..|.:|    |.:.:|                  
Human   211 KTQWTSLGL-EDVQFVNYSVLLDLPGPSPSTVTLSSSGQCFHPNGQPCSEEARKDSSQDLLYSYA 274

  Fly   209 --SSVGTGDAELMVVT--MLETLRLM-----ATSEETFLH----PIVFLFNGAEEQPFHGSHSFI 260
              |:.||..||::.|:  |.:.|:.:     .|::...|.    |:::..:..|:..|.|...:|
Human   275 AYSAKGTLKAEVIDVSYGMADDLKRIRKIKNVTNQIALLKLGKLPLLYKLSSLEKAGFGGVLLYI 339

  Fly   261 SNHRWSANCKALVN------LDSAGAGGREILFQGGPNHPWLMKQYKKSAKHPFATTMAEEIFQA 319
            .    ..:....||      :.|...||.    ...|.:|.:.:.:::|..:  .|::..:...|
Human   340 D----PCDLPKTVNPSHDTFMVSLNPGGD----PSTPGYPSVDESFRQSRSN--LTSLLVQPISA 394

  Fly   320 DLI 322
            .|:
Human   395 PLV 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33012NP_788335.2 M28_Fxna_like 103..410 CDD:193497 47/265 (18%)
NAALADL2XP_011510914.1 Peptidases_S8_S53 268..420 CDD:299169 26/140 (19%)
Zinc_peptidase_like 437..659 CDD:301362
TFR_dimer 686..>744 CDD:282153
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.