DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33012 and Tfrc

DIOPT Version :9

Sequence 1:NP_788335.2 Gene:CG33012 / 36342 FlyBaseID:FBgn0053012 Length:912 Species:Drosophila melanogaster
Sequence 2:NP_001344227.1 Gene:Tfrc / 22042 MGIID:98822 Length:763 Species:Mus musculus


Alignment Length:352 Identity:64/352 - (18%)
Similarity:128/352 - (36%) Gaps:91/352 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 YPLFNHLPTGVKIEEEANLPG----TFVAQRAESILIRLDLMGP---------KIAGDYVTEVEM 135
            :|.|||  |.....:.:.||.    |.....||.:..:::...|         |:.   :::.:.
Mouse   315 FPSFNH--TQFPPSQSSGLPNIPVQTISRAAAEKLFGKMEGSCPARWNIDSSCKLE---LSQNQN 374

  Fly   136 VEFLLGEISKVRDEMRNDLYDMEVDVQRSSGSFLHWQMINMYQGIQNVVVKLSSKSSNSTSYLLV 200
            |:.::..:.|.|                        :::|::..|:..        .....|::|
Mouse   375 VKLIVKNVLKER------------------------RILNIFGVIKGY--------EEPDRYVVV 407

  Fly   201 NSHYD------SKPSSVGTGDAELMVVTMLETLRLMATSEETF--LHPIVFLFNGAEEQPFHGSH 257
            .:..|      :..||||||    :::.:.:....| .|::.|  ...|:|....|.:....|:.
Mouse   408 GAQRDALGAGVAAKSSVGTG----LLLKLAQVFSDM-ISKDGFRPSRSIIFASWTAGDFGAVGAT 467

  Fly   258 SFISNHRWSANCKAL--VNLDSAGAGGREILFQGGPNHPWLMKQYKKSAKHPF-ATTMAEE---I 316
            .::..:..|.:.||.  :|||....|.........|....||.:..:..|||. ..::..:   |
Mouse   468 EWLEGYLSSLHLKAFTYINLDKVVLGTSNFKVSASPLLYTLMGKIMQDVKHPVDGKSLYRDSNWI 532

  Fly   317 FQADLIPSDTDFRIFRDFGPVPGLDMAGC------YNGFVYHTKFDRYKVIS----------RGA 365
            .:.:.:..|.....|..:..:|.:....|      |.|    |:.|.|:.::          |.|
Mouse   533 SKVEKLSFDNAAYPFLAYSGIPAVSFCFCEDADYPYLG----TRLDTYEALTQKVPQLNQMVRTA 593

  Fly   366 LQNTGDNVLSLVRSIS-NAE-EMYDTE 390
            .:..|..::.|...:. |.: |||:::
Mouse   594 AEVAGQLIIKLTHDVELNLDYEMYNSK 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33012NP_788335.2 M28_Fxna_like 103..410 CDD:193497 58/333 (17%)
TfrcNP_001344227.1 Mediates interaction with SH3BP4. /evidence=ECO:0000250 1..67
Endocytosis signal 20..23
Stop-transfer sequence 58..61
PA_TfR 203..379 CDD:239043 13/68 (19%)
Zinc_peptidase_like 387..613 CDD:326366 46/242 (19%)
Ligand-binding. /evidence=ECO:0000250 572..763 10/49 (20%)
TFR_dimer 645..749 CDD:309400
Cell attachment site. /evidence=ECO:0000255 649..651
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.