DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33012 and Y39A3B.1

DIOPT Version :9

Sequence 1:NP_788335.2 Gene:CG33012 / 36342 FlyBaseID:FBgn0053012 Length:912 Species:Drosophila melanogaster
Sequence 2:NP_497490.2 Gene:Y39A3B.1 / 189721 WormBaseID:WBGene00021436 Length:371 Species:Caenorhabditis elegans


Alignment Length:141 Identity:27/141 - (19%)
Similarity:62/141 - (43%) Gaps:28/141 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 DEMRNDL---------YDMEVDVQRS--------------SGSFLHWQMINMYQGIQNVVVKLSS 189
            |.|::||         .:.|..|.|:              :.:|:|.:...:  |...:.|:...
 Worm    28 DRMKHDLSKFLSISRFNETEKSVARAAIKRALEAVGLNSMTHTFIHEESNEV--GANVIAVQKGP 90

  Fly   190 K-SSNSTSYLLVNSHYDSKPSSVGTGDAELMVVTMLETLRLMATSEETF--LHPIVFLFNGAEEQ 251
            . .:.:...::::::||:...:.|..|....|..:||..|:::|.:..:  .:.||::|...:.:
 Worm    91 YFGTGNDKMMILSANYDTLEGNQGVDDNGSGVAAVLEAARVLSTLDNLYSRQNTIVYVFFDMKHK 155

  Fly   252 PFHGSHSFISN 262
            ...|||:|:.:
 Worm   156 ALAGSHAFVED 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33012NP_788335.2 M28_Fxna_like 103..410 CDD:193497 27/141 (19%)
Y39A3B.1NP_497490.2 M28_like 17..349 CDD:349893 27/141 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.