DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33012 and NAALAD2

DIOPT Version :9

Sequence 1:NP_788335.2 Gene:CG33012 / 36342 FlyBaseID:FBgn0053012 Length:912 Species:Drosophila melanogaster
Sequence 2:XP_016872532.1 Gene:NAALAD2 / 10003 HGNCID:14526 Length:775 Species:Homo sapiens


Alignment Length:409 Identity:91/409 - (22%)
Similarity:137/409 - (33%) Gaps:129/409 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 NLPGTFVAQR------------------AESILIRLDL---MG-PKIAGDYV--TEVEMVEFLLG 141
            ||||| .|||                  |:....|||:   :| |:|....:  .:.|::...||
Human   272 NLPGT-AAQRGNVLNLNGAGDPLTPGYPAKEYTFRLDVEEGVGIPRIPVHPIGYNDAEILLRYLG 335

  Fly   142 EISKVRDEMRNDLYDMEVDVQRSSG-------SF----LHWQMINMYQGIQNVVVKLSSKSSNST 195
            .|:......:..|     :|..|.|       ||    :|...||....|.|||..:.. |....
Human   336 GIAPPDKSWKGAL-----NVSYSIGPGFTGSDSFRKVRMHVYNINKITRIYNVVGTIRG-SVEPD 394

  Fly   196 SYLLVNSHYDSKPSSVGTGDAELMVVTMLETLRLMATSEETFLHP---IVFLFNGAEEQPFHGSH 257
            .|:::..|.||  ...|..|....|..:.|..|...........|   |:|....|||      .
Human   395 RYVILGGHRDS--WVFGAIDPTSGVAVLQEIARSFGKLMSKGWRPRRTIIFASWDAEE------F 451

  Fly   258 SFISNHRWS-ANCK-------ALVNLDSAGAGGREILFQGGPNHPWLMKQ--YKKSAKHPF---- 308
            ..:.:..|: .|.|       |.:|.||:..|...:.....|    |:.|  ||.:.:.|.    
Human   452 GLLGSTEWAEENVKILQERSIAYINSDSSIEGNYTLRVDCTP----LLYQLVYKLTKEIPSPDDG 512

  Fly   309 --ATTMAEEIFQADLIP------------SDTDFR-IFRDFGPVPG---------LDMAGCYNGF 349
              :.::.|...:.|..|            |.:||. .|:..|...|         .|....|.  
Human   513 FESKSLYESWLEKDPSPENKNLPRINKLGSGSDFEAYFQRLGIASGRARYTKNKKTDKYSSYP-- 575

  Fly   350 VYHTKFDRYKVIS----------------RGAL--------------QNTGDNVLSLVRSISNAE 384
            ||||.::.::::.                ||||              |:..:.:.:...||.|..
Human   576 VYHTIYETFELVEKFYDPTFKKQLSVAQLRGALVYELVDSKIIPFNIQDYAEALKNYAASIYNLS 640

  Fly   385 EMYDTEAHSEGHSVFFDYL 403
            :.:|.:.  ..|.|.||.|
Human   641 KKHDQQL--TDHGVSFDSL 657

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33012NP_788335.2 M28_Fxna_like 103..410 CDD:193497 89/407 (22%)
NAALAD2XP_016872532.1 Zinc_peptidase_like 93..>139 CDD:301362
PA_GCPII_like 145..371 CDD:239036 25/104 (24%)
M28_PSMA_like 373..620 CDD:193568 55/261 (21%)
TFR_dimer 657..772 CDD:282153 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.