DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8839 and AMI1

DIOPT Version :9

Sequence 1:NP_610764.1 Gene:CG8839 / 36340 FlyBaseID:FBgn0033717 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_563831.1 Gene:AMI1 / 837418 AraportID:AT1G08980 Length:425 Species:Arabidopsis thaliana


Alignment Length:454 Identity:110/454 - (24%)
Similarity:182/454 - (40%) Gaps:81/454 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 ALIKSGQYSTEELEKEKPFL-GVPITTKDCISVKGMLHTAGL--FERRDVRAARDADAMALMRKA 163
            |.|:....|........|.| |:....||...|:|.:...|.  :.|....|...|..::.:.:|
plant     9 AFIEKVTISPTSTSSSPPSLQGLTFAIKDIFDVEGRVTGFGNPDWLRTHSAATSTAPVVSSLLEA 73

  Fly   164 GAIPIALTNVSEVCMWWESNNTVHGRTRNAYDTNRIVGGSSGGEGCIQSAAASAFGLGSDIGGSI 228
            ||..:.:|.:.|:.......|..:|..||....:|:.||||.|.....:|....|.:|:|.|||:
plant    74 GATALGITIMDEMAYSINGENAHYGTPRNPIAFDRVPGGSSSGSAVAVAARLVDFSIGTDTGGSV 138

  Fly   229 RMPAFFNGIFGHKPSKLVVSNVGQFPAPFSAEQNSFLGLGPMSRFAEDLR--------------- 278
            |:||.:.||||.:||...||.||..|.     ..||..:|..:|....|:               
plant   139 RVPASYCGIFGFRPSHGAVSTVGLTPM-----AQSFDTVGWFARDTATLKRVGCVLLQQHHLNPI 198

  Fly   279 -PMLKIMAGEKAALLNLDEDVDLTKMKFFYQESDGGGRLVSAVD---------PDLREAMNRVAQ 333
             |...|:|.:...|.::..|:.:..:....::|.||..:|..|:         |.|:..|.....
plant   199 EPSQLIIADDCFKLCSVPHDLLVQPLVGSVEKSFGGNTVVKKVNLGEYIGQNVPSLKHFMTSDDV 263

  Fly   334 HLREKFG-------NQKVERIQLPHFRQSAAIWFANMRDDSGHGFAYQLGNLNHDINTYLELFKW 391
            ..:::|.       :..:..:|...|:.:...|.::::.:.|.|.:.:                 
plant   264 TTQQEFCIPSLMALSSSMRLLQRHEFKINHGAWISSVKPEFGPGISER----------------- 311

  Fly   392 FFGASKHTFIGLSTAIMDSAQCKHGSPKYDHLVRKRNELREELQSLLGDNGVLIYPTHPTVAPYH 456
                       :..||..|.:      |.||....::||...|.:|||:.|||:.||.|...|:.
plant   312 -----------IEEAIRTSDE------KIDHCRSVKSELITALSTLLGEKGVLVIPTVPGPPPHL 359

  Fly   457 NEPIT-----RPINFAYTGIVNVLGFPATAVPLGKLGSEGLPLGVQIIANFNQDRLCLAVAEEL 515
            ...:.     |...|:...|..|.||...::|||.  .|.||:.|.::|.:..|...|::.:.|
plant   360 QANVAALESFRSRAFSLLSIAGVSGFCQVSIPLGL--HENLPVSVSLVAKYGSDGFLLSLVDSL 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8839NP_610764.1 GatA 42..525 CDD:223232 110/454 (24%)
PRK07488 49..520 CDD:236030 110/454 (24%)
AMI1NP_563831.1 PLN02722 1..425 CDD:166363 110/454 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0154
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.