DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Den1 and CG4452

DIOPT Version :9

Sequence 1:NP_001163126.1 Gene:Den1 / 36339 FlyBaseID:FBgn0033716 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_648303.1 Gene:CG4452 / 39069 FlyBaseID:FBgn0035981 Length:390 Species:Drosophila melanogaster


Alignment Length:151 Identity:30/151 - (19%)
Similarity:47/151 - (31%) Gaps:46/151 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 NETTDAGGSHWSLLVFSRPEKTFYHFDSYGNNN------TGNSLELMNKIKDLLGVRMAKFRPMR 189
            :|.|.:  ||.......:|.:........|.||      :|..|:|.:||....|.......|..
  Fly   155 HEKTSS--SHRDSAAAKKPSRNELGKSGSGANNSGVNAVSGAGLDLPDKISRGNGGNGTIAAPAA 217

  Fly   190 CLQQANGYDCGIHVICMT---DHIA--------------------------------DYLNRYEV 219
            .....|..|   ||:.:|   :.||                                |..||.:.
  Fly   218 ITVDTNSSD---HVVAITYLKERIASLEKRLNQKDKELLEKDKQLTELKGKNFEKENDMRNRLKE 279

  Fly   220 IDGLPSLHIDTVKAKRTELLK 240
            ::.|..:.:|.:..|...:||
  Fly   280 VERLHDMKVDNLNRKIASVLK 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Den1NP_001163126.1 Peptidase_C48 66..204 CDD:304959 18/78 (23%)
CG4452NP_648303.1 FAM76 6..310 CDD:292665 30/151 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445277
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.