DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Den1 and ulp-3

DIOPT Version :9

Sequence 1:NP_001163126.1 Gene:Den1 / 36339 FlyBaseID:FBgn0033716 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001023477.1 Gene:ulp-3 / 3565434 WormBaseID:WBGene00006738 Length:210 Species:Caenorhabditis elegans


Alignment Length:187 Identity:62/187 - (33%)
Similarity:91/187 - (48%) Gaps:12/187 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LTFHDSCLRMSDVQLL-HGPHWLNDQILSFYYEYLAHMKYKTNADLHFIAPEITQCMKYMG-DQE 108
            |::....|...||.:| |...|.||::|:|..|:| .......|::....|..|:.:::.. |:|
 Worm     9 LSYESVVLTADDVTILEHTGCWFNDKLLTFCAEFL-EQHNSAAAEIQIFTPPQTEMIRHSTCDEE 72

  Fly   109 LKQLLDQSNTTGKPFIFFALNDNE--TTDAGGSHWSLLVFSRPEKTFYHFDSYGNNNTGNSLELM 171
            :.......:...|..|.|.:|||:  |...||||||||:|.|....|.||||...:|...:..||
 Worm    73 VDMYFGCLDVNSKDLIAFIVNDNQDVTRVNGGSHWSLLIFDRKIDKFRHFDSARGHNLKIAENLM 137

  Fly   172 NKIKDLLGVRMAK--FRPMRCLQQANGYDCGIHV-----ICMTDHIADYLNRYEVID 221
            .|.:.|:..|.::  ..|..||||.|..|||:||     :......||.:.:.|.||
 Worm   138 QKSRKLVRQRQSQRNLEPELCLQQKNASDCGLHVAQYLAVLAEQKSADAIGKLEKID 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Den1NP_001163126.1 Peptidase_C48 66..204 CDD:304959 51/147 (35%)
ulp-3NP_001023477.1 ULP1 <12..171 CDD:227489 54/159 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167015
Domainoid 1 1.000 86 1.000 Domainoid score I5172
eggNOG 1 0.900 - - E1_COG2828
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I3660
Isobase 1 0.950 - 0 Normalized mean entropy S3849
OMA 1 1.010 - - QHG54524
OrthoDB 1 1.010 - - D1313098at2759
OrthoFinder 1 1.000 - - FOG0004372
OrthoInspector 1 1.000 - - oto17841
orthoMCL 1 0.900 - - OOG6_103852
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R806
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.690

Return to query results.
Submit another query.